missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Deoxyguanosine kinase Monoclonal antibody specifically detects Deoxyguanosine kinase in Human samples. It is validated for Western Blot, ELISA, KnockDown
Specifications
Specifications
| Antigen | Deoxyguanosine kinase |
| Applications | Western Blot, ELISA, KnockDown |
| Classification | Monoclonal |
| Clone | 3E9 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Alias | deoxyguanosine kinase, deoxyguanosine kinase, mitochondrial, DGK, dGKmitochondrial deoxyguanosine kinase, EC 2.7.1.113, MTDPS3 |
| Host Species | Mouse |
| Immunogen | DGUOK (NP_001920, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIGLHCPKSWKLAGYDVPGASTMVLHIPDIFLFEPPESTAGALP |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?