missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Deoxycytidylate deaminase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | Deoxycytidylate deaminase |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Deoxycytidylate deaminase Polyclonal specifically detects Deoxycytidylate deaminase in Human samples. It is validated for Western Blot.Specifications
| Deoxycytidylate deaminase | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| dCMP deaminaseEC 3.5.4.12, deoxycytidylate deaminase, MGC111062 | |
| DCTD | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| D3DP49 | |
| 1635 | |
| Synthetic peptides corresponding to DCTD(dCMP deaminase) The peptide sequence was selected from the middle region of DCTD. Peptide sequence MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title