missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DELGEF Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £470.00
Specifications
| Antigen | DELGEF |
|---|---|
| Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18644456
|
Novus Biologicals
NBP2-38366-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18168557
|
Novus Biologicals
NBP2-38366 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DELGEF Polyclonal specifically detects DELGEF in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| DELGEF | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Deafness locus-associated putative guanine nucleotide exchange factor, DelGEF, DELGEFdeafness locus associated putative guanine nucleotide exchange factor, Gnefr, Guanine nucleotide exchange factor-related protein, secretion regulating guanine nucleotide exchange factor, secretion-regulating guanine nucleotide exchange factor | |
| SERGEF | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9UGK8 | |
| 26297 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: WTHLVAQTETGKMFTWGRADYGQLGRKLETYEGWKLEKQDSFLPCSRPPNSMPSSPHCLTGATEVSCGSEHNLAIIGGVCYSWGWNEH | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title