missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Deleted in azoospermia 4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | Deleted in azoospermia 4 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Deleted in azoospermia 4 Polyclonal specifically detects Deleted in azoospermia 4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Deleted in azoospermia 4 | |
| Polyclonal | |
| Rabbit | |
| deleted in azoospermia 4, deleted in azoospermia protein 4, pDP1680, pDP1681 | |
| DAZ4 | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| 57135 | |
| Synthetic peptides corresponding to DAZ4 (deleted in azoospermia 4) The peptide sequence was selected from the N terminal of DAZ4. Peptide sequence MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title