missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DEGS2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10844-100UL
This item is not returnable.
View return policy
Description
DEGS2 Polyclonal specifically detects DEGS2 in Mouse samples. It is validated for Western Blot.
Specifications
| DEGS2 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| C14orf66, chromosome 14 open reading frame 66, Degenerative spermatocyte homolog 2, degenerative spermatocyte homolog 2, lipid desaturase (Drosophila), DES2sphingolipid delta(4)-desaturase/C4-hydroxylase DES2, EC 1.14, FADS8, sphingolipid C4-hydroxylase/delta 4-desaturase, sphingolipid delta 4 desaturase/C-4 hydroxylase | |
| The immunogen is a synthetic peptide directed towards the C terminal region of mouse DEGS2 (NP_001164473.1). Peptide sequence TFNVGYHMEHHDFPSIPGYYLPLVRKIAPEYYDHLPQHHSWVKVLWDFVF | |
| 100 μg | |
| Lipid and Metabolism | |
| 123099 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction