missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Defensin alpha 5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17669-100UL
This item is not returnable.
View return policy
Description
Defensin alpha 5 Polyclonal antibody specifically detects Defensin alpha 5 in Human samples. It is validated for Immunofluorescence
Specifications
| Defensin alpha 5 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| DEF5defensin, alpha 5, preproprotein, defensin 5, Defensin, alpha 5, defensin, alpha 5, Paneth cell-specific, defensin-5, HD-5, MGC129728 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR | |
| 100 μg | |
| Immunology, Innate Immunity | |
| 1670 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion