missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Defensin alpha 5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£231.00 - £443.00
Specifications
| Antigen | Defensin alpha 5 |
|---|---|
| Concentration | 0.2mg/mL |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18400371
|
Novus Biologicals
NBP1-84282-25ul |
25 μL |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18750654
|
Novus Biologicals
NBP1-84282 |
£443.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
Defensin alpha 5 Polyclonal specifically detects Defensin alpha 5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Defensin alpha 5 | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500 | |
| Polyclonal | |
| Rabbit | |
| Immunology, Innate Immunity | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 1670 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| 0.2mg/mL | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| DEF5defensin, alpha 5, preproprotein, defensin 5, Defensin, alpha 5, defensin, alpha 5, Paneth cell-specific, defensin-5, HD-5, MGC129728 | |
| DEFA5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title