missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DEFB107A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | DEFB107A |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18220444
|
Novus Biologicals
NBP2-59793 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18611067
|
Novus Biologicals
NBP2-59793-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DEFB107A Polyclonal specifically detects DEFB107A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DEFB107A | |
| Polyclonal | |
| Purified | |
| RUO | |
| BD-7, Beta-Defensin 107, Beta-Defensin 7, DEFB107, DEFB107A DEFB107B, DEFB7, DEFB-7, Defensin Beta 107A, Defensin, Beta 107A, Defensin, Beta 7 | |
| DEFB107A | |
| IgG | |
| Protein A purified |
| Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Unconjugated | |
| Rabbit | |
| Human | |
| 245910 | |
| This antibody was developed against a recombinant protein corresponding to the amino acid sequence:QARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only (RUO)
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title