missing translation for 'onlineSavingsMsg'
Learn More
Learn More
dedicator of cytokinesis 8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17049-25UL
This item is not returnable.
View return policy
Description
dedicator of cytokinesis 8 Polyclonal antibody specifically detects dedicator of cytokinesis 8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| dedicator of cytokinesis 8 | |
| Polyclonal | |
| Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| dedicator of cytokinesis 8, FLJ00026, FLJ00346 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: INRYSSAEIRKQFTLPPNLGQYHRQSISTSGFPSLQLPQFYDPVEPVDFEGLLMTHLNSLDVQLAQELGDFTDDDLDVVF | |
| 25 μg | |
| Cardiovascular Biology, Signal Transduction | |
| 81704 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction