DEDD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-68959-25ul

Product Code. 18695348

Beschreibung

DEDD Polyclonal antibody specifically detects DEDD in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Spezifikation

• Antigen: DEDD
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: CASP8IP1, death effector domain containing, death effector domain-containing, death effector domain-containing protein, Death effector domain-containing testicular molecule, DEDD1, DEDPRO1, DEFTKE05, FLDED1, FLDED-1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEETSIRYVTPRALSD
• Quantity: 25 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 9191
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified