DECR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18470772	Novus Biologicals NBP1-85263-25ul	25ul
18211276	Novus Biologicals NBP1-85263	0.1 mL

Description

DECR1 Polyclonal specifically detects DECR1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DECR1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: 2,4-dienoyl CoA reductase 1, mitochondrial, 4-enoyl-CoA reductase, 4-enoyl-CoA reductase [NADPH], DECR, DECR2,4-dienoyl-CoA reductase [NADPH]2,4-dienoyl-CoA reductase, mitochondrial, EC 1.3.1.34, NADPH, SDR18C1, short chain dehydrogenase/reductase family 18C, member 1
• Gene Symbols: DECR1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cancer, Signal Transduction
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 1666
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKT
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only