DEC2/SHARP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58737

Product Code. 18217323

Description

DEC2/SHARP1 Polyclonal specifically detects DEC2/SHARP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: DEC2/SHARP1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: basic helix-loop-helix domain containing, class B, 3, basic helix-loop-helix family, member e41, bHLHb3, BHLHB3class E basic helix-loop-helix protein 41, bHLHe41, Class B basic helix-loop-helix protein 3, DEC2Enhancer-of-split and hairy-related protein 1, Differentially expressed in chondrocytes protein 2, SHARP-1, SHARP1hDEC2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79365
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: BHLHE41
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PFCLPFCFLSPSAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLY
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only