missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18349228

DEAF1 Antibody (3F11), Novus Biologicals™

Product Code. 18349228 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18349228 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18349228 Supplier Novus Biologicals Supplier No. H00010522M05

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

DEAF1 Monoclonal antibody specifically detects DEAF1 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen DEAF1
Applications Western Blot, ELISA
Classification Monoclonal
Clone 3F11
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_066288
Gene Alias deformed epidermal autoregulatory factor 1 (Drosophila), Nuclear DEAF-1-related transcriptional regulator, NUDRdeformed epidermal autoregulatory factor 1 homolog, SPNsuppressin, Zinc finger MYND domain-containing protein 5, ZMYND5Suppressin
Host Species Mouse
Immunogen DEAF1 (NP_066288.2, 133 a.a. ~ 222 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TALQIGDSLNTEKATLIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSG
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10522
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.