missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DDX56 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-80990
This item is not returnable.
View return policy
Description
DDX56 Polyclonal specifically detects DDX56 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| DDX56 | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Q9NY93 | |
| DDX56 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TGPVVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVRVANVSAAEDSVSQRAVLMEKPDVVVGTPSRILSHLQQDSLKLRDS | |
| 0.1 mL | |
| DNA replication Transcription Translation and Splicing | |
| 54606 | |
| Human, Mouse, Rat | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ATP-dependent 61 kDa nucleolar RNA helicase, DDX26, DEAD (Asp-Glu-Ala-Asp) box polypeptide 56, DEAD box protein 21, DEAD box protein 56, DEAD-box RNA helicase, EC 3.6.1, EC 3.6.4.13,61-kd nucleolar helicase, NOH61DDX21, probable ATP-dependent RNA helicase DDX56, putative nucleolar RNA helicase | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction