missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DDX55 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-57332
This item is not returnable.
View return policy
Description
DDX55 Polyclonal specifically detects DDX55 in Human samples. It is validated for Western Blot.
Specifications
| DDX55 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| DEAD (Asp-Glu-Ala-Asp) box polypeptide 55, DEAD box protein 55, EC 3.6.1, EC 3.6.4.13, FLJ16577, KIAA1595ATP-dependent RNA helicase DDX55, MGC33209 | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 57696 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q8NHQ9 | |
| DDX55 | |
| Synthetic peptides corresponding to DDX55 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 55) The peptide sequence was selected from the C terminal of DDX55. Peptide sequence GKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIK. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Guinea pig: 92%; Chicken: 91%; Rabbit: 91%; Zebrafish: 91%; Xenopus: 76%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction