missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DDX52 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10805-100UL
This item is not returnable.
View return policy
Description
DDX52 Polyclonal specifically detects DDX52 in Human samples. It is validated for Western Blot.
Specifications
| DDX52 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| ATP-dependent RNA helicase ROK1-like, DEAD (Asp-Glu-Ala-Asp) box polypeptide 52, DEAD box protein 52, EC 3.6.1, HUSSY19, probable ATP-dependent RNA helicase DDX52, ROK1EC 3.6.4.13 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human DDX52 (NP_008941.2). Peptide sequence SSEVLQGLDFFGNKKSVPGVCGASQTHQKPQNGEKKEESLTERKREQSKK | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 11056 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction