DDX52 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-33776

Product Code. 18184485

Description

DDX52 Polyclonal specifically detects DDX52 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DDX52
• Classification: Polyclonal
• Dilution: Western Blot, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q9Y2R4
• Gene Symbols: DDX52
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KFDTRRFSADAARFQIGKRKYDFDSSEVLQGLDFFGNKKSVPGVCGASQTHQKPQNGEKKEESLTERKREQSKKKRKTMTSEIAS
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ATP-dependent RNA helicase ROK1-like, DEAD (Asp-Glu-Ala-Asp) box polypeptide 52, DEAD box protein 52, EC 3.6.1, HUSSY19, probable ATP-dependent RNA helicase DDX52, ROK1EC 3.6.4.13
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11056
• Target Species: Human
• Isotype: IgG

For Research Use Only