DDX49 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-47491-25ul

Product Code. 18618775

Description

DDX49 Polyclonal specifically detects DDX49 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DDX49
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: DEAD (Asp-Glu-Ala-Asp) box polypeptide 49, DEAD box protein 49, EC 3.6.1, EC 3.6.4.13, FLJ10432, probable ATP-dependent RNA helicase DDX49, R27090_2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54555
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: DDX49
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TLVTQYDIHLVHAIEEQIKKKLEEFSVEEAEVLQILTQVNVVRRECEIKLEAAHFDEKKEINKRKQLILEGKDPDLEAKRKAELAKIKQKN
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only