DDX47 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57295

Product Code. 18266984

Description

DDX47 Polyclonal specifically detects DDX47 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DDX47
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DEAD (Asp-Glu-Ala-Asp) box polypeptide 47, DEAD box polypeptide 47, DEAD box protein 47, DKFZp564O176, E4-DBP, E4-DEAD box protein, EC 3.6.1, EC 3.6.4.13, FLJ30012, HQ0256, MSTP162, probable ATP-dependent RNA helicase DDX47, RRP3
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51202
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q9H0S4
• Gene Symbols: DDX47
• Immunogen: Synthetic peptides corresponding to DDX47 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 47) The peptide sequence was selected from the C terminal of DDX47. Peptide sequence AQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Canine: 92%; Equine: 85%; Rabbit: 85%; Mouse: 78%; Rat: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast
• Form: Purified