missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DDX46 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-83565
This item is not returnable.
View return policy
Description
DDX46 Polyclonal specifically detects DDX46 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.
Specifications
| DDX46 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated | |
| DEAD (Asp-Glu-Ala-Asp) box polypeptide 46, DEAD box protein 46, EC 3.6.1, EC 3.6.4.13, FLJ25329, KIAA0801probable ATP-dependent RNA helicase DDX46, MGC9936, Prp5, PRP5 homolog, Prp5-like DEAD-box protein, PRPF5, RNA helicase | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 9879 | |
| Human, Mouse, Rat | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DDX46 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KEGNEMEGEELDPLDAYMEEVKEEVKKFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAM | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction