missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18346549

Novus Biologicals™ DDX43 Antibody (3G12), Novus Biologicals™

Product Code. 18346549 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18346549 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18346549 Supplier Novus Biologicals™ Supplier No. H00055510M07

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

DDX43 Monoclonal antibody specifically detects DDX43 in Human samples. It is validated for ELISA,Western Blot,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen DDX43
Applications ELISA, Western Blot, Sandwich ELISA, Immunocytochemistry/Immunofluorescence
Classification Monoclonal
Clone 3G12
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA 1:100-1:2000, Immunocytochemistry/ Immunofluorescence 10 μg/mL, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_061135
Gene Alias Cancer/testis antigen 13, CT13DEAD-box protein 43, DEAD (Asp-Glu-Ala-Asp) box polypeptide 43, DEAD box protein 43, DKFZp434H2114, EC 3.6.1, EC 3.6.4.13, HAGEDEAD box protein HAGE, Helical antigen, probable ATP-dependent RNA helicase DDX43
Host Species Mouse
Immunogen DDX43 (NP_061135.1, 2 a.a. ∽ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHHGGAPKASTWVVASRRSSTVSRAPERRPAEELNRTGPEGYSVGRGGRWRGTSRPPEAVAAGHEELPLCFALKSHFVGAVIGRGGSKI
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55510
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.