missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DDX31 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£361.00
Specifications
| Antigen | DDX31 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
DDX31 Polyclonal specifically detects DDX31 in Human samples. It is validated for Western Blot.Specifications
| DDX31 | |
| Polyclonal | |
| Purified | |
| RUO | |
| DEAD (Asp-Glu-Ala-Asp) box polypeptide 31, DEAD box protein 31, DEAD/DEXH helicase DDX31, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 31, EC 3.6.1, EC 3.6.4.13, FLJ13633, FLJ14578, FLJ23349, G2 helicase, helicain, probable ATP-dependent RNA helicase DDX31 | |
| DDX31 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Q9H8H2-4 | |
| 64794 | |
| Synthetic peptides corresponding to DDX31 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 31) The peptide sequence was selected from the N terminal of DDX31. Peptide sequence QASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title