DDX31 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57349

Product Code. 18275935

Description

DDX31 Polyclonal specifically detects DDX31 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DDX31
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DEAD (Asp-Glu-Ala-Asp) box polypeptide 31, DEAD box protein 31, DEAD/DEXH helicase DDX31, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 31, EC 3.6.1, EC 3.6.4.13, FLJ13633, FLJ14578, FLJ23349, G2 helicase, helicain, probable ATP-dependent RNA helicase DDX31
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64794
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H8H2-4
• Gene Symbols: DDX31
• Immunogen: Synthetic peptides corresponding to DDX31 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 31) The peptide sequence was selected from the N terminal of DDX31. Peptide sequence QASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 85%; Rat: 78%.
• Target Species: Human, Mouse, Rat, Guinea Pig
• Form: Purified