missing translation for 'onlineSavingsMsg'
Learn More

DDX3 Antibody (2D7), Novus Biologicals™

Product Code. 18380849 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18380849 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18380849 Supplier Novus Biologicals Supplier No. H00008653M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

DDX3 Monoclonal antibody specifically detects DDX3 in Human, Mouse samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen DDX3
Applications Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Sandwich ELISA
Classification Monoclonal
Clone 2D7
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_004651
Gene Alias DBXCAP-Rf, DDX14, DDX3DEAD/H box-3, DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked, DEAD box protein 3, X-chromosomal, DEAD box, X isoform, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3, EC 3.6.1, EC 3.6.4.13, helicase like protein 2, Helicase-like protein 2, HLP2ATP-dependent RNA helicase DDX3X
Host Species Mouse
Immunogen DDX3Y (NP_004651, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDAYSSFGSRDSRGK
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 1654
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.