missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DDX18 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | DDX18 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
DDX18 Polyclonal specifically detects DDX18 in Human samples. It is validated for Western Blot.Specifications
| DDX18 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS buffer, 2% sucrose | |
| 8886 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| DEAD (Asp-Glu-Ala-Asp) box polypeptide 18, DEAD box protein 18, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 18 (Myc-regulated), EC 3.6.1, EC 3.6.4.13, FLJ33908, MrDbATP-dependent RNA helicase DDX18, Myc-regulated DEAD box protein | |
| The immunogen is a synthetic peptide directed towards the C terminal region of human DDX18 (NP_006764.3). Peptide sequence VALSFGFKVPPFVDLNVNSNEGKQKKRGGGGGFGYQKTKKVEKSKIFKHI | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title