DDX1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57379

Product Code. 18259952

Description

DDX1 Polyclonal specifically detects DDX1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DDX1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ATP-dependent RNA helicase DDX1, DBP-RBDEAD box polypeptide 1, DEAD (Asp-Glu-Ala-Asp) box polypeptide 1, DEAD box protein 1, DEAD box protein retinoblastoma, DEAD box-1, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1, EC 3.6.1, EC 3.6.1.10, EC 3.6.4.13, UKVH5d
• Host Species: Rabbit
• Molecular Weight of Antigen: 81 kDa
• Quantity: 100 μL
• Research Discipline: Cancer, Neuroscience, Transcription Factors and Regulators, Vision
• Gene ID (Entrez): 1653
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q92499
• Gene Symbols: DDX1
• Immunogen: Synthetic peptides corresponding to DDX1 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 1) The peptide sequence was selected from the C terminal of DDX1. Peptide sequence SQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEK.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

For Research Use Only