Invitrogen™ DDAH1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA595366

Product Code. 16334635

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HUVEC whole cell, human HepG2 whole cell, human Caco-2 whole cell, human SH-SY5Y whole cell, rat brain tissue, rat liver tissue, mouse brain tissue, mouse liver tissue . Flow: A431 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.

Specifications

• Antigen: DDAH1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: DDAH1
• Gene Alias: 2410006N07Rik; 2510015N06Rik; AI987801; AW050362; Ddah; Ddah1; DDAH-1; DDAHI; dimethylargininase-1; dimethylarginine dimethylaminohydrolase 1; epididymis secretory protein Li 16; FLJ21264; FLJ25539; HEL-S-16; N(G),N(G)-dimethylarginine dimethylaminohydrolase 1; NG, NG-dimethylarginine dimethylaminohydrolase; NG,NG dimethylarginine dimethylaminohydrolase; RP4-621F18.1
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 23576, 64157, 69219
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: O08557, O94760, Q9CWS0
• Gene Symbols: DDAH1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH1 (195-226aa QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG