missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
DCTN5 Polyclonal antibody specifically detects DCTN5 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | DCTN5 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS with 50% glycerol, pH7.3. |
| Gene Alias | dynactin 4, dynactin 5 (p25), dynactin subunit 5, Dynactin subunit p25, MGC3248, p25 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DCTN5 (NP_115875.1). MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVN |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?