missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DBX2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | DBX2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DBX2 Polyclonal specifically detects DBX2 in Human samples. It is validated for Western Blot.Specifications
| DBX2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| developing brain homeobox 2, developing brain homeobox protein 2, FLJ16139, homeobox protein DBX2 | |
| DBX2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001004329 | |
| 440097 | |
| Synthetic peptide directed towards the N terminal of human DBX2The immunogen for this antibody is DBX2. Peptide sequence ALLNLPAAPGFGNLGKSFLIENLLRVGGAPTPRLQPPAPHDPATALATAG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title