missing translation for 'onlineSavingsMsg'
Learn More

DBT Antibody, Novus Biologicals™

Product Code. 18414161 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18414161 25 μL 25µL
18227088 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18414161 Supplier Novus Biologicals Supplier No. NBP18952225ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

DBT Polyclonal specifically detects DBT in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen DBT
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias BCATE2BCKAD E2 subunit, BCKADE2, BCKAD-E2, branched chain acyltransferase, E2 component, Branched-chain alpha-keto acid dehydrogenase complex component E2, Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto aciddehydrogenase complex, Dihydrolipoamide branched chain transacylase, dihydrolipoamide branched chain transacylase (E2 component of branched chainketo acid dehydrogenase complex; maple syrup urine disease), dihydrolipoamide branched chain transacylase E2, dihydrolipoyl transacylase, Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase, E2, E2 component of branched chain alpha-keto acid dehydrogenase complex, E2B, EC 2.3.1.168, lipoamide acyltransferase component of branched-chain alpha-keto aciddehydrogenase complex, mitochondrial, lipoamide acyltransferase component of mitochondrial branched-chain alpha-ketoacid dehydrogenase complex, MGC9061, mitochondrial branched chain alpha-keto acid dehydrogenase transacylase subunit(E2b)
Gene Symbols DBT
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQ
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 1629
Test Specificity Specificity of human DBT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.