missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18331249

DBPA Antibody (1H5), Novus Biologicals™

Product Code. 18331249 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18331249 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18331249 Supplier Novus Biologicals Supplier No. H00008531M06

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

DBPA Monoclonal antibody specifically detects DBPA in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen DBPA
Applications Western Blot, ELISA, Immunocytochemistry
Classification Monoclonal
Clone 1H5
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_003642
Gene Alias cold shock domain protein A, Cold shock domain-containing protein A, cold-shock domain protein A, CSDA1, dbpA, DBPAcold-shock domain containing A1, DNA-binding protein A, Single-strand DNA-binding protein NF-GMB, ZO-1-associated nucleic acid-binding protein, ZONAB
Host Species Mouse
Immunogen CSDA (NP_003642, 241 a.a. ~ 330 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYR
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8531
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.