missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ DAZAP2 Antibody (3G21), Novus Biologicals™

Product Code. 18344849 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18344849 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18344849 Supplier Novus Biologicals™ Supplier No. H00009802M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

DAZAP2 Monoclonal antibody specifically detects DAZAP2 in Human samples. It is validated for ELISA,Western Blot,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen DAZAP2
Applications ELISA, Western Blot, Sandwich ELISA, Immunocytochemistry/Immunofluorescence
Classification Monoclonal
Clone 3G21
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_055579
Gene Alias DAZ associated protein 2, deleted in azoospermia associated protein 2, Deleted in azoospermia-associated protein 2, KIAA0058DAZ-associated protein 2, MGC14319, MGC766, proline-rich transcript in brain, proline-rich transcript, brain-expressed protein, PRTB
Host Species Mouse
Immunogen DAZAP2 (NP_055579, 93 a.a. ∽ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9802
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.