DAPP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-33452

Product Code. 18109192

Description

DAPP1 Polyclonal specifically detects DAPP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DAPP1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9UN19
• Gene Symbols: DAPP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQG
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 27071
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: B lymphocyte adapter protein Bam32, BAM32DKFZp667E0716, B-cell adapter molecule of 32 kDa, dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide, dual adaptor of phosphotyrosine and 3-phosphoinositides, hDAPP1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only