missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18344648

Novus Biologicals™ DAP5 Antibody (3B5), Novus Biologicals™

Product Code. 18344648 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18344648 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18344648 Supplier Novus Biologicals™ Supplier No. H00001982M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

DAP5 Monoclonal antibody specifically detects DAP5 in Human,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen DAP5
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 3B5
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_001409
Gene Alias aging-associated protein 1, DAP-5, DAP5AAG1, Death-associated protein 5, eIF4G 2, eIF-4G 2, eIF-4-gamma 2, eukaryotic translation initiation factor 4 gamma 2, eukaryotic translation initiation factor 4 gamma, 2, eukaryotic translation initiation factor 4G-like 1, FLJ41344, NAT1, p97
Host Species Mouse
Immunogen EIF4G2 (NP_001409, 811 a.a. ∽ 889 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQ
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Apoptosis, mTOR Pathway
Primary or Secondary Primary
Gene ID (Entrez) 1982
Target Species Human, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.