missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DAP12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-85313-25ul
This item is not returnable.
View return policy
Description
DAP12 Polyclonal specifically detects DAP12 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| DAP12 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| DAP12PLOSL, DNAX-activation protein 12, KARAPPLO-SL, KAR-associated protein, killer activating receptor associated protein, Killer-activating receptor-associated protein, TYRO protein tyrosine kinase binding protein, TYRO protein tyrosine kinase-binding protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| TYROBP | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK | |
| 25 μL | |
| Apoptosis, Signal Transduction | |
| 7305 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction