missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DACH2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | DACH2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DACH2 Polyclonal specifically detects DACH2 in Human, Mouse samples. It is validated for Western Blot.Specifications
| DACH2 | |
| Polyclonal | |
| Rabbit | |
| NP_444511 | |
| 117154 | |
| Synthetic peptide directed towards the C terminal of human DACH2. Peptide sequence TKRKLQEALEFESKRREQVEQALKQATTSDSGLRMLKDTGIPDIEIENNG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Dach2, dachshund homolog 2, dachshund homolog 2 (Drosophila), FLJ31391, MGC138545 | |
| DACH2 | |
| IgG | |
| 65 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title