D-Glutamate Cyclase Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92381-0.02ml

Product Code. 18673710

Description

D-Glutamate Cyclase Polyclonal antibody specifically detects D-Glutamate Cyclase in Rat samples. It is validated for Western Blot

Specifications

• Antigen: D-Glutamate Cyclase
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: Chromosome 2 Open Reading Frame 37, DCAF17, DDB1 And CUL4 Associated Factor 17, DDB1- And CUL4-Associated Factor 17
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 235-335 of human DCAF17 (NP_079276.2). LYSFQTIAEQFMQQKLDLGCACRWGGTTGTVGEAPFGIPCNIKITDMPPLLFEVSSLENAFQIGGHPWHYIVTPNKKKQKGVFHICALKDNSLAKNGIQEM
• Quantity: 0.02 mL
• Research Discipline: Cell Biology
• Gene ID (Entrez): 80067
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Rat
• Form: Purified