missing translation for 'onlineSavingsMsg'
Learn More
Learn More
D-Glutamate Cyclase Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92381-0.1ml
This item is not returnable.
View return policy
Description
D-Glutamate Cyclase Polyclonal antibody specifically detects D-Glutamate Cyclase in Rat samples. It is validated for Western Blot
Specifications
| D-Glutamate Cyclase | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| Chromosome 2 Open Reading Frame 37, DCAF17, DDB1 And CUL4 Associated Factor 17, DDB1- And CUL4-Associated Factor 17 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 235-335 of human DCAF17 (NP_079276.2). LYSFQTIAEQFMQQKLDLGCACRWGGTTGTVGEAPFGIPCNIKITDMPPLLFEVSSLENAFQIGGHPWHYIVTPNKKKQKGVFHICALKDNSLAKNGIQEM | |
| 0.1 mL | |
| Cell Biology | |
| 80067 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction