missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Cytosolic Sulfotransferase 2B1/SULT2B1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Cytosolic Sulfotransferase 2B1/SULT2B1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18321692
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18321692 25 μg 25µL
18321644 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18321692 Supplier Bio-Techne Supplier No. NBP31699725UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Cytosolic Sulfotransferase 2B1/SULT2B1 Polyclonal antibody specifically detects Cytosolic Sulfotransferase 2B1/SULT2B1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Cytosolic Sulfotransferase 2B1/SULT2B1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias Alcohol sulfotransferase, EC 2.8.2, EC 2.8.2.2, HSST2sulfotransferase family cytosolic 2B member 1, Hydroxysteroid sulfotransferase 2, ST2B1, Sulfotransferase 2B1, sulfotransferase family, cytosolic, 2B, member 1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: KAKVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDH
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 6820
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.