missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Cytosolic Sulfotransferase 2B1/SULT2B1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Cytosolic Sulfotransferase 2B1/SULT2B1 Polyclonal specifically detects Cytosolic Sulfotransferase 2B1/SULT2B1 in Human samples. It is validated for Western Blot.Specifications
| Cytosolic Sulfotransferase 2B1/SULT2B1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Alcohol sulfotransferase, EC 2.8.2, EC 2.8.2.2, HSST2sulfotransferase family cytosolic 2B member 1, Hydroxysteroid sulfotransferase 2, ST2B1, Sulfotransferase 2B1, sulfotransferase family, cytosolic, 2B, member 1 | |
| SULT2B1 | |
| IgG | |
| 39 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O00204-2 | |
| 6820 | |
| Synthetic peptides corresponding to SULT2B1(sulfotransferase family, cytosolic, 2B, member 1) The peptide sequence was selected from the N terminal of SULT2B1. Peptide sequence MASPPPFHSQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFI. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title