missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£157.00 - £358.00
Specifications
| Antigen | Cytosolic Sulfotransferase 1C4/SULT1C4 |
|---|---|
| Dilution | Western Blot 1:200-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Cytosolic Sulfotransferase 1C4/SULT1C4 Polyclonal antibody specifically detects Cytosolic Sulfotransferase 1C4/SULT1C4 in Mouse, Rat samples. It is validated for Western BlotSpecifications
| Cytosolic Sulfotransferase 1C4/SULT1C4 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Biology, Endocrinology, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 27233 | |
| IgG | |
| Affinity purified |
| Western Blot 1:200-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| EC 2.8.2, EC 2.8.2.-, EC 2.8.2.1, MGC149521, MGC34422, ST1C4, Sulfotransferase 1C2, sulfotransferase family, cytosolic, 1C, member 4, sulfotransferase family, cytosolic, 1C, member C2, SULT1C#2, SULT1C2cytosolic, 1C, member 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SULT1C4 (NP_006579.2). MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel