Cytokeratin 20 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Product Code	Brand	Quantity
18485082	Novus Biologicals NBP1-85599-25ul	25 μL
18240258	Novus Biologicals NBP1-85599	0.1 mL

Description

Cytokeratin 20 Polyclonal specifically detects Cytokeratin 20 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Cytokeratin 20
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Mouse
• Gene Accession No.: P35900
• Gene ID (Entrez): 54474
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMAMQNLND
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Molecular Weight of Antigen: 48 kDa

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:1000-1:2500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cytoskeleton Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CD20, CK20, CK-20, cytokeratin-20, K20cytokeratin 20, keratin 20, keratin, type I cytoskeletal 20, keratin-20, KRT21, MGC35423, Protein IT
• Gene Symbols: KRT20
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only