Cytohesin 4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35478-100ul

Product Code. 30232309

Description

Cytohesin 4 Polyclonal antibody specifically detects Cytohesin 4 in Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: Cytohesin 4
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA
• Gene Alias: CYT4PH, SEC7 and coiled-coil domain-containing protein 4, cytohesin 4, cytohesin-4, pleckstrin homology, Sec7 and coiled/coil domains 4, pleckstrin homology, Sec7 and coiled-coil domains 4, PSCD4DJ63G5.1
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human Cytohesin 4 (NP_037517.1).,, Sequence:, MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQKEKELCIGRK
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Mouse, Rat
• Form: Purified

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27128
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG