missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytohesin 4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35478-100ul
This item is not returnable.
View return policy
Description
Cytohesin 4 Polyclonal antibody specifically detects Cytohesin 4 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| Cytohesin 4 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| CYT4PH, SEC7 and coiled-coil domain-containing protein 4, cytohesin 4, cytohesin-4, pleckstrin homology, Sec7 and coiled/coil domains 4, pleckstrin homology, Sec7 and coiled-coil domains 4, PSCD4DJ63G5.1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human Cytohesin 4 (NP_037517.1).,, Sequence:, MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQKEKELCIGRK | |
| 100 μL | |
| Primary | |
| Mouse, Rat | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 27128 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido