Cytohesin 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Brand:  Novus Biologicals NBP1-90097

Product Code. 18284627

Description

Cytohesin 3 Polyclonal specifically detects Cytohesin 3 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Cytohesin 3
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: ARF nucleotide-binding site opener 3, ARNO3PH, SEC7 and coiled-coil domain-containing protein 3, cytohesin 3, General receptor of phosphoinositides 1, Grp1, GRP1cytohesin-3, pleckstrin homology, Sec7 and coiled-coil domains 3, Protein ARNO3, PSCD3pleckstrin homology, Sec7 and coiled/coil domains 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human Cytohesin 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CYTH3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAM
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 9265
• Target Species: Human, Mouse
• Isotype: IgG

For Research Use Only