missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18397118

Cytohesin 2 Antibody (5E11), Novus Biologicals™

Product Code. 18397118 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18397118 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18397118 Supplier Novus Biologicals Supplier No. H00009266M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Cytohesin 2 Monoclonal antibody specifically detects Cytohesin 2 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen Cytohesin 2
Applications Western Blot, ELISA
Classification Monoclonal
Clone 5E11
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_059431
Gene Alias ARF exchange factor, ARF nucleotide-binding site opener, ARNOPH, SEC7 and coiled-coil domain-containing protein 2, CTS18.1, cytohesin 2, pleckstrin homology, Sec7 and coiled-coil domains 2 (cytohesin-2), Protein ARNO, PSCD2LCTS18, PSCD2pleckstrin homology, Sec7 and coiled-coil domains 2, Sec7 and coiled/coil domains 2 (cytohesin-2)
Host Species Mouse
Immunogen CYTH2 (NP_059431, 314 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQE
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Membrane Trafficking and Chaperones
Primary or Secondary Primary
Gene ID (Entrez) 9266
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.