missing translation for 'onlineSavingsMsg'
Learn More

Cytochrome p450 2J2 Antibody (2D10), Novus Biologicals™

Product Code. 18378667 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18378667 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18378667 Supplier Novus Biologicals Supplier No. H00001573M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Cytochrome p450 2J2 Monoclonal antibody specifically detects Cytochrome p450 2J2 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Cytochrome p450 2J2
Applications Western Blot, ELISA, Immunocytochemistry
Classification Monoclonal
Clone 2D10
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_000766
Gene Alias Arachidonic acid epoxygenase, CPJ2, CYPIIJ2, cytochrome P450 2J2, cytochrome P450, family 2, subfamily J, polypeptide 2, cytochrome P450, subfamily IIJ (arachidonic acid epoxygenase) polypeptide 2, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase
Host Species Mouse
Immunogen CYP2J2 (NP_000766, 408 a.a. ~ 498 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LHRDPTEWATPDTFNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITISPVSHRLCA
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 1573
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.