missing translation for 'onlineSavingsMsg'
Learn More

Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8), Novus Biologicals™

Product Code. 18392448 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18392448 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18392448 Supplier Novus Biologicals Supplier No. H00001345M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Cytochrome C Oxidase subunit 6c Monoclonal antibody specifically detects Cytochrome C Oxidase subunit 6c in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Cytochrome C Oxidase subunit 6c
Applications Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 4G4-2A8
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH00187
Gene Alias Cytochrome c oxidase polypeptide VIc, cytochrome c oxidase subunit 6C, cytochrome c oxidase subunit VIc, cytochrome c oxidase subunit VIc preprotein
Host Species Mouse
Immunogen COX6C (AAH00187, 1 a.a. ~ 75 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1345
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.