Cysteine Conjugate beta-Lyase/CCBL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Product Code	Brand	Quantity
18439390	Novus Biologicals NBP1-83317-25ul	25 μL
18263017	Novus Biologicals NBP1-83317	0.1 mL

Description

Cysteine Conjugate beta-Lyase/CCBL1 Polyclonal specifically detects Cysteine Conjugate beta-Lyase/CCBL1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Cysteine Conjugate beta-Lyase/CCBL1
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: cysteine conjugate-beta lyase, cytoplasmic, cysteine conjugate-beta lyase; cytoplasmic (glutamine transaminase K, Cysteine-S-conjugate beta-lyase, EC 2.6.1.64, EC 2.6.1.7, EC 4.4.1.13, FLJ95217, Glutamine transaminase K, glutamine-phenylpyruvate aminotransferase, Glutamine--phenylpyruvate transaminase, GTKMGC29624, KAT1, KATIbeta-lysase, kidney, kyneurenine aminotransferase, kyneurenine aminotransferase), Kynurenine aminotransferase I, kynurenine--oxoglutarate transaminase 1, Kynurenine--oxoglutarate transaminase I
• Gene Symbols: CCBL1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 883
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVF
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only