missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18369717

Cystatin SN Antibody, Novus Biologicals™

Product Code. 18369717 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18369717 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18369717 Supplier Novus Biologicals Supplier No. H00001469B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

Cystatin SN Polyclonal antibody specifically detects Cystatin SN in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Cystatin SN
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulation PBS (pH 7.4)
Gene Accession No. NP_001889.2
Gene Alias cystain-SA-I, cystatin 1, cystatin SA-I, cystatin SN, cystatin-1, cystatin-SN, Salivary cystatin-SA-1, type 2 family
Host Species Mouse
Immunogen CST1 (NP_001889.2, 1 a.a. - 141 a.a.) full-length human protein. MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES
Purification Method IgG purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Proteases & Other Enzymes
Primary or Secondary Primary
Gene ID (Entrez) 1469
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.