missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cystatin-9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Cystatin-9 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Cystatin-9 Polyclonal specifically detects Cystatin-9 in Human samples. It is validated for Western Blot.Specifications
| Cystatin-9 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| cystatin 9 (testatin) | |
| CST9 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001008693 | |
| 128822 | |
| Synthetic peptide directed towards the middle region of human CST9. Peptide Sequence: IDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title